Request QuoteCatalog Number: xP520857MVHSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L23 (rplW)

Recombinant 50S ribosomal protein L23 (rplW) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520857MVHYeast1mgQuote
EP520857MVHE. coli1mgQuote
BP520857MVHBaculovirus200ugQuote
MP520857MVHMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium bovis
UniProt IDO06046
Gene NamerplW; Locus:Mb0723
Protein Name50S ribosomal protein L23
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIAVEKIFAVKVASVNTA NRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review