Request QuoteCatalog Number: xP513795GFRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L20 (rplT)

Recombinant 50S ribosomal protein L20 (rplT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513795GFRYeast1mgQuote
EP513795GFRE. coli1mgQuote
BP513795GFRBaculovirus200ugQuote
MP513795GFRMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter sp. (strain M21)
UniProt IDC6DYJ2
Gene NamerplT; Locus:GM21_2227
Protein Name50S ribosomal protein L20
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL WITRINAAARINGLSYSKLIHGLKLANVEIDRKVMADLAVSDPNGFAAIAAAAKAKF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review