Request QuoteCatalog Number: xP509184DUHSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L20 (rplT)

Recombinant 50S ribosomal protein L20 (rplT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509184DUHYeast1mgQuote
EP509184DUHE. coli1mgQuote
BP509184DUHBaculovirus200ugQuote
MP509184DUHMammalian Cell200ugQuote

Protein Information

SpeciesClostridium botulinum (strain Kyoto / Type A2)
UniProt IDC1FKM7
Gene NamerplT; Locus:CLM_3542
Protein Name50S ribosomal protein L20
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMARVKRAMNARKRHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDYRKL WIARINAATRMNGLSYSKFMNGIKNAGIDINRKMLSEIAINDPKAFAELVDVAKKQLNA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review