Request QuoteCatalog Number: xP522851FPZSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L17 (rplQ)

Recombinant 50S ribosomal protein L17 (rplQ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522851FPZYeast1mgQuote
EP522851FPZE. coli1mgQuote
BP522851FPZBaculovirus200ugQuote
MP522851FPZMammalian Cell200ugQuote

Protein Information

SpeciesSynechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
UniProt IDO24711
Gene NamerplQ; aka: rpl17; Locus:syc1889_d
Protein Name50S ribosomal protein L17
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMRHRCNVPQLGRPADQRKALLRSLTTEIIRNGTVTTTKARAKAVRSEVERMVTLAKDGSL AARRQALGYIYDKQLVHLLFEQAPERYAKRQGGYTRILRTVRRRGDNAEMAIIELT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review