Request QuoteCatalog Number: xP509591TMTSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L30e (rpl30e)

Recombinant 50S ribosomal protein L30e (rpl30e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509591TMTYeast1mgQuote
EP509591TMTE. coli1mgQuote
BP509591TMTBaculovirus200ugQuote
MP509591TMTMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus sibiricus (strain MM 739 / DSM 12597)
UniProt IDC6A1G2
Gene Namerpl30e; Locus:TSIB_0391
Protein Name50S ribosomal protein L30e
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMDLAFELRKAIETGKVVIGSNETMRLARTGEAKLIIMAKNAPKEVKDDINYYAGLSSIPV YEFEGTSVELGTLLGKPFVIALMAIVEPGESKILSLAGGK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review