Request QuoteCatalog Number: xP515735DZVSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L27, chloroplastic (rpl27)

Recombinant 50S ribosomal protein L27, chloroplastic (rpl27) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515735DZVYeast1mgQuote
EP515735DZVE. coli1mgQuote
BP515735DZVBaculovirus200ugQuote
MP515735DZVMammalian Cell200ugQuote

Protein Information

SpeciesCyanidium caldarium
UniProt IDO19885
Gene Namerpl27
Protein Name50S ribosomal protein L27, chloroplastic
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMAHKKGSGSSKNGRDSNAKYLGIKKFGKQIVTPGQIIVRQRGTKIKPGLNVGLGRDYTIF SMIAGRVNYSTQKNKKIVSVDPSYGKIQAIEIRKASHFAT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review