Request QuoteCatalog Number: xP020430OFOSize: 0.2-1mg

Request Quote

Recombinant 40S ribosomal protein S28 (rps-28)

Recombinant 40S ribosomal protein S28 (rps-28) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020430OFOYeast1mgQuote
EP020430OFOE. coli1mgQuote
BP020430OFOBaculovirus200ugQuote
MP020430OFOMammalian Cell200ugQuote

Protein Information

SpeciesOstertagia ostertagi
UniProt IDO61590
Gene Namerps-28
Protein Name40S ribosomal protein S28
Region Expressed1-66
Expression Tag6xHis
Purity>90%
AA SequenceMDKPVKPAXVTKNIGRTGSQGQCTQVRVEFMDDNGNRTINRNVKGPVREGDILTLLEAER EARRLR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review