Request QuoteCatalog Number: xP309405BUDSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP309405BUDYeast1mgQuote
EP309405BUDE. coli1mgQuote
BP309405BUDBaculovirus200ugQuote
MP309405BUDMammalian Cell200ugQuote

Protein Information

SpeciesBorrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
UniProt IDP94266
Gene NamerpsJ; Locus:BB_0477
Protein Name30S ribosomal protein S10
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMIAKDKIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNK KSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIKQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review