Request QuoteCatalog Number: xP304158SSQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP304158SSQYeast1mgQuote
EP304158SSQE. coli1mgQuote
BP304158SSQBaculovirus200ugQuote
MP304158SSQMammalian Cell200ugQuote

Protein Information

SpeciesSynechocystis sp. (strain PCC 6803 / Kazusa)
UniProt IDP73316
Gene NamerpsS; aka: rps19; Locus:ssl3432
Protein Name30S ribosomal protein S19
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMGRSLKKGPFVAASLLRKIDKLNDKGDKQVVKTWSRASTILPQMVGHTIAVHNGRQHVPV FVSEQMVGHKLGEFAPTRTFRSHSKSDKKARK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review