Request QuoteCatalog Number: xP530066FHXSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S17P (rps17p)

Recombinant 30S ribosomal protein S17P (rps17p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP530066FHXYeast1mgQuote
EP530066FHXE. coli1mgQuote
BP530066FHXBaculovirus200ugQuote
MP530066FHXMammalian Cell200ugQuote

Protein Information

SpeciesPyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
UniProt IDO59426
Gene Namerps17p; Locus:PH1770
Protein Name30S ribosomal protein S17P
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMEKMVRDIGLRIQPPAEKCDDPKCPWHGHLKIHGRVFEGIVISDKPRKTVTVERQYYHYL KKYERYELRRSRIHAHNPPCINAKVGDRVLIAETRPLSKTKHFVVVAVLERAEERR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review