Request QuoteCatalog Number: xP530478GHGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6, chloroplastic (rps6)

Recombinant 30S ribosomal protein S6, chloroplastic (rps6) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP530478GHGYeast1mgQuote
EP530478GHGE. coli1mgQuote
BP530478GHGBaculovirus200ugQuote
MP530478GHGMammalian Cell200ugQuote

Protein Information

SpeciesGuillardia theta (Cryptomonas phi)
UniProt IDO78447
Gene Namerps6
Protein Name30S ribosomal protein S6, chloroplastic
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMTKLNSYETLYIVKPELTEDSLAKLIESYQGLLLERGAKNIITQNRGRRTLKYMIKKYKD AHYVQMNYEGNGEVIQLLERAMKINESIVRFLTTAI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review