Request QuoteCatalog Number: xP527031DSBSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S20 (rpsT)

Recombinant 30S ribosomal protein S20 (rpsT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527031DSBYeast1mgQuote
EP527031DSBE. coli1mgQuote
BP527031DSBBaculovirus200ugQuote
MP527031DSBMammalian Cell200ugQuote

Protein Information

SpeciesChlamydia trachomatis (strain D/UW-3/Cx)
UniProt IDO84622
Gene NamerpsT; aka: rs20; Locus:CT_617
Protein Name30S ribosomal protein S20
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMAPRKPSKKVGPQKRPSAEKRVITSKKKQLRNQSFKSKVRTILKKFELAVQSGDVESISA GLRSVYSIADKAVKRGIFKKGKADRVKSRTSERACPAA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review