Request QuoteCatalog Number: xP529461DSBSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529461DSBYeast1mgQuote
EP529461DSBE. coli1mgQuote
BP529461DSBBaculovirus200ugQuote
MP529461DSBMammalian Cell200ugQuote

Protein Information

SpeciesChlamydia trachomatis (strain D/UW-3/Cx)
UniProt IDO84029
Gene NamerpsP; aka: rs16; Locus:CT_026
Protein Name30S ribosomal protein S16
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLN QGAELTEKAGALVKQGAPGVYAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review