Request QuoteCatalog Number: xP524086DNVSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524086DNVYeast1mgQuote
EP524086DNVE. coli1mgQuote
BP524086DNVBaculovirus200ugQuote
MP524086DNVMammalian Cell200ugQuote

Protein Information

SpeciesAquifex aeolicus (strain VF5)
UniProt IDO66523
Gene NamerpsP; Locus:aq_123
Protein Name30S ribosomal protein S16
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRKVLINVYPEKVKEWVL KGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRESKKSKGGEAA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review