Request QuoteCatalog Number: xP512976DJQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512976DJQYeast1mgQuote
EP512976DJQE. coli1mgQuote
BP512976DJQBaculovirus200ugQuote
MP512976DJQMammalian Cell200ugQuote

Protein Information

SpeciesDesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
UniProt IDC6C189
Gene NamerpsS; Locus:Desal_1189
Protein Name30S ribosomal protein S19
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMPRSLKKGPFIDDHLLKKVVKAQESGDRKVIQTWSRRSTIIPEMVGLTFAVHNGRKFIPV FVTENMVGHKLGEFSPTRTYYGHAADKKSKAKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review