Request QuoteCatalog Number: xP505387DJPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505387DJPYeast1mgQuote
EP505387DJPE. coli1mgQuote
BP505387DJPBaculovirus200ugQuote
MP505387DJPMammalian Cell200ugQuote

Protein Information

SpeciesDesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
UniProt IDC4XLX2
Gene NamerpsJ; Locus:DMR_12190
Protein Name30S ribosomal protein S10
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMVSMQNDRIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTDIHKVTVNRSVHV DKKSREQFEMRVHKRLLDIMEPTQQTVDALGKLSLPAGVDVEIKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review