Request QuoteCatalog Number: xP512421KBRSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S17 (rpsQ)

Recombinant 30S ribosomal protein S17 (rpsQ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512421KBRYeast1mgQuote
EP512421KBRE. coli1mgQuote
BP512421KBRBaculovirus200ugQuote
MP512421KBRMammalian Cell200ugQuote

Protein Information

SpeciesKosmotoga olearia (strain TBF 19.5.1)
UniProt IDC5CGQ5
Gene NamerpsQ; Locus:Kole_1893
Protein Name30S ribosomal protein S17
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMPRKKLVGTVVSNKMDKTVVVRVERTFAHPLYKKTVKRAKKYHAHDEDNSCGIGDIVEIE ECRPLSKTKKFKVVRIVKKSVFGEEKLETPENVEMLGGEEK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review