Request QuoteCatalog Number: xP513498KBRSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513498KBRYeast1mgQuote
EP513498KBRE. coli1mgQuote
BP513498KBRBaculovirus200ugQuote
MP513498KBRMammalian Cell200ugQuote

Protein Information

SpeciesKosmotoga olearia (strain TBF 19.5.1)
UniProt IDC5CEB3
Gene NamerpsP; Locus:Kole_1461
Protein Name30S ribosomal protein S16
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMVKIRLTRMGRRNRPFYRIVVVDSRKRRDGAYIDSLGFYDPVKDPAVMSVDVEKAVEWIL KGAQPTDTARSILSKFGVMKKVHEIKYGKKTEEEGNE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review