Request QuoteCatalog Number: xP512407MTPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512407MTPYeast1mgQuote
EP512407MTPE. coli1mgQuote
BP512407MTPBaculovirus200ugQuote
MP512407MTPMammalian Cell200ugQuote

Protein Information

SpeciesMicrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
UniProt IDC5CC63
Gene NamerpsJ; Locus:Mlut_17170
Protein Name30S ribosomal protein S10
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMAGQKIRIRLKSYDHEVIDVSARKIVDTVTRAGATVVGPVPLPTEKNVYCVIRSPHKYKD SREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review