Request QuoteCatalog Number: xP517853HTMSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S17P (rps17p)

Recombinant 30S ribosomal protein S17P (rps17p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517853HTMYeast1mgQuote
EP517853HTME. coli1mgQuote
BP517853HTMBaculovirus200ugQuote
MP517853HTMMammalian Cell200ugQuote

Protein Information

SpeciesHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
UniProt IDO24786
Gene Namerps17p; Locus:VNG_1700G
Protein Name30S ribosomal protein S17P
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMAIGLNVTEPEGTCSDEDCPFHGNLSVRGQVLEGEVASTDMEKTVVVEREYDVFVPKYDR YMKRRSRVPAHAPECFDISVGDTVSIAETRPLSKTKSHVVVEITDGGDA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review