Request QuoteCatalog Number: xP522847FPZSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522847FPZYeast1mgQuote
EP522847FPZE. coli1mgQuote
BP522847FPZBaculovirus200ugQuote
MP522847FPZMammalian Cell200ugQuote

Protein Information

SpeciesSynechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
UniProt IDO24693
Gene NamerpsS; aka: rps19; Locus:syc1869_d
Protein Name30S ribosomal protein S19
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMARSLKKGPFVADHLLRKVEKLNAKGDKQVIKTWSRASTILPQMIGHTIAVHNGRQHVPV YVTEQMVGHKLGEFAPTRTFRGHTKDKKAGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review