Request QuoteCatalog Number: xP499768RLKSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S17 (rpsQ)

Recombinant 30S ribosomal protein S17 (rpsQ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP499768RLKYeast1mgQuote
EP499768RLKE. coli1mgQuote
BP499768RLKBaculovirus200ugQuote
MP499768RLKMammalian Cell200ugQuote

Protein Information

SpeciesRhodococcus erythropolis (strain PR4 / NBRC 100887)
UniProt IDC0ZW34
Gene NamerpsQ; Locus:RER_18610
Protein Name30S ribosomal protein S17
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMSEEKAVSTEERASRKVRVGYVVSDKMEKTIVVELEDRVKHKLYGKIIRRTTKVKAHDEN GVAGVGDRVQLMETRPLSATKHWRLVEVLEKAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review