Request QuoteCatalog Number: xP507330BWLSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S20 (rpsT)

Recombinant 30S ribosomal protein S20 (rpsT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP507330BWLYeast1mgQuote
EP507330BWLE. coli1mgQuote
BP507330BWLBaculovirus200ugQuote
MP507330BWLMammalian Cell200ugQuote

Protein Information

SpeciesBrevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
UniProt IDC0ZB21
Gene NamerpsT; Locus:BBR47_20030
Protein Name30S ribosomal protein S20
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMPNIKSAIKRTKTIEKRRAHRASQKSDLRTSIKNFEKAVAASDVALAKSTLLVAVKKLDK AASKGLIHKNAANRQKSRLMKKLNVLSAPVA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review