Request QuoteCatalog Number: xP510845TMPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S24e (rps24e)

Recombinant 30S ribosomal protein S24e (rps24e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510845TMPYeast1mgQuote
EP510845TMPE. coli1mgQuote
BP510845TMPBaculovirus200ugQuote
MP510845TMPMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
UniProt IDC5A442
Gene Namerps24e; Locus:TGAM_0502
Protein Name30S ribosomal protein S24e
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMEIKVTEIRENKLLGRKEIYFDIIHEGEPTPSREAVKGKLAAMLDLDPNTMVLQYIRSYF GSHVSKGYAKAYETRERMLYIEPEYILLRDGLIQKEEE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review