Request QuoteCatalog Number: xP521695AXGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S12 (rpsL)

Recombinant 30S ribosomal protein S12 (rpsL) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP521695AXGYeast1mgQuote
EP521695AXGE. coli1mgQuote
BP521695AXGBaculovirus200ugQuote
MP521695AXGMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae (Haemophilus pleuropneumoniae)
UniProt IDO31194
Gene NamerpsL
Protein Name30S ribosomal protein S12
Region Expressed1-82
Expression Tag6xHis
Purity>90%
AA SequenceRGVCTRVYTTTPKKPNSALXKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDL PGVRYHTVRGALDCASVKDRKQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review