Request QuoteCatalog Number: xP497897BQQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP497897BQQYeast1mgQuote
EP497897BQQE. coli1mgQuote
BP497897BQQBaculovirus200ugQuote
MP497897BQQMammalian Cell200ugQuote

Protein Information

SpeciesBacillus cereus (strain Q1)
UniProt IDB9IZJ3
Gene NamerpsJ; Locus:BCQ_0122
Protein Name30S ribosomal protein S10
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVHKYKD SREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review