Request QuoteCatalog Number: xP494816FNRSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494816FNRYeast1mgQuote
EP494816FNRE. coli1mgQuote
BP494816FNRBaculovirus200ugQuote
MP494816FNRMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus uberis (strain ATCC BAA-854 / 0140J)
UniProt IDB9DSV4
Gene NamerpsS; Locus:SUB0072
Protein Name30S ribosomal protein S19
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPV YIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review