Request QuoteCatalog Number: xP506546WBPSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP506546WBPYeast1mgQuote
EP506546WBPE. coli1mgQuote
BP506546WBPBaculovirus200ugQuote
MP506546WBPMammalian Cell200ugQuote

Protein Information

SpeciesWolbachia sp. subsp. Drosophila simulans (strain wRi)
UniProt IDC0R3M3
Gene NamerpsP; Locus:WRi_007670
Protein Name30S ribosomal protein S16
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLARFGAKKRPFYRIVVADSRAPRDGRFIEKIGQYDPMLPKDNKNRVVVKADRLK HWLSVGAQATERVLWFIKKGIVTLETEPKKTEKKKVENEKAQGQEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review