Request QuoteCatalog Number: xP504792TOQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504792TOQYeast1mgQuote
EP504792TOQE. coli1mgQuote
BP504792TOQBaculovirus200ugQuote
MP504792TOQMammalian Cell200ugQuote

Protein Information

SpeciesTolumonas auensis (strain DSM 9187 / TA4)
UniProt IDC4L7S9
Gene NamerpsJ; Locus:Tola_0098
Protein Name30S ribosomal protein S10
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD ARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review