Request QuoteCatalog Number: xP504339HUGSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S13 (rpsM)

Recombinant 30S ribosomal protein S13 (rpsM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504339HUGYeast1mgQuote
EP504339HUGE. coli1mgQuote
BP504339HUGBaculovirus200ugQuote
MP504339HUGMammalian Cell200ugQuote

Protein Information

SpeciesHamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
UniProt IDC4K796
Gene NamerpsM; Locus:HDEF_1844
Protein Name30S ribosomal protein S13
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMARIAGINIPDKKHAVIALTSIYGIGRTTALDICAKTGVSAAVKISELSEKQIEELREQV AKYTVEGDLRREVTLNIKRLMDIGTYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review