Request QuoteCatalog Number: xP504212RMXSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S16 (rpsP)

Recombinant 30S ribosomal protein S16 (rpsP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP504212RMXYeast1mgQuote
EP504212RMXE. coli1mgQuote
BP504212RMXBaculovirus200ugQuote
MP504212RMXMammalian Cell200ugQuote

Protein Information

SpeciesRickettsia peacockii (strain Rustic)
UniProt IDC4K2Y3
Gene NamerpsP; Locus:RPR_07690
Protein Name30S ribosomal protein S16
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMAVKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYDPMLASDNSERVVLKKDRIE YWLGTGAKPTERVAKFIEQAGVTLPEKVKKEMEVKAKNRKARLSKKEAKEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review