Request QuoteCatalog Number: xP451352DSSSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S20 (rpsT)

Recombinant 30S ribosomal protein S20 (rpsT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP451352DSSYeast1mgQuote
EP451352DSSE. coli1mgQuote
BP451352DSSBaculovirus200ugQuote
MP451352DSSMammalian Cell200ugQuote

Protein Information

SpeciesChlorobium phaeobacteroides (strain BS1)
UniProt IDB3ELQ7
Gene NamerpsT; Locus:Cphamn1_0421
Protein Name
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMPLHKSAEKRLRQSARRNERNRARKKELKVLLKTVQKLVDTNADKKEVEAAYRSAIQKLD RLGVKRYIHPNKASRKKSQLSRMLNNYMKAE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review