Request QuoteCatalog Number: xP474282HUYSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP474282HUYYeast1mgQuote
EP474282HUYE. coli1mgQuote
BP474282HUYBaculovirus200ugQuote
MP474282HUYMammalian Cell200ugQuote

Protein Information

SpeciesHelicobacter pylori (strain P12)
UniProt IDB6JNF8
Gene NamerpsJ; Locus:HPP12_1284
Protein Name
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMEKIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSR EQFEIRFYSRLIDIISATPETVDSLMKLDLAPEVDVEVTSMETK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review