Request QuoteCatalog Number: xP469393ENWSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP469393ENWYeast1mgQuote
EP469393ENWE. coli1mgQuote
BP469393ENWBaculovirus200ugQuote
MP469393ENWMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain SE11)
UniProt IDB6I230
Gene NamerpsS; Locus:ECSE_3591
Protein Name
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPV FVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review