Request QuoteCatalog Number: xP467024AZMSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S14 (rpsN)

Recombinant 30S ribosomal protein S14 (rpsN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP467024AZMYeast1mgQuote
EP467024AZME. coli1mgQuote
BP467024AZMBaculovirus200ugQuote
MP467024AZMMammalian Cell200ugQuote

Protein Information

SpeciesAliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238) )
UniProt IDB6EPT8
Gene NamerpsN; Locus:VSAL_I0333
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMAKQSMKAREAKRAKLVTKFAEKRAALKVLISDVNASEEDRWNAVLKLQSLPRDSSASRQ RNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review