Request QuoteCatalog Number: xP307077DBESize: 0.2-1mg

Request Quote

Recombinant (R) -2- (2,4-dichlorophenoxy) propionate,2-oxoglutarate dioxygenase

Recombinant (R) -2- (2,4-dichlorophenoxy) propionate,2-oxoglutarate dioxygenase can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP307077DBEYeast1mgQuote
EP307077DBEE. coli1mgQuote
BP307077DBEBaculovirus200ugQuote
MP307077DBEMammalian Cell200ugQuote

Protein Information

SpeciesDelftia acidovorans (Pseudomonas acidovorans) (Comamonas acidovorans)
UniProt IDP83310
Gene NamerdpA
Protein Name (R) -2- (2,4-dichlorophenoxy) propionate,2-oxoglutarate dioxygenase
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMHAALSPLSQRFEXIAVQPLTGGVNEILDAFHTYQVIYFPGQAITNEQHIAFSRETLSPT MQATIEGLNSIEGYPEVQMIRREANESGRVIGDDXHTXII
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review