Request QuoteCatalog Number: xP355877MOSize: 0.2-1mg

Request Quote

Recombinant 16.5 kDa submandibular gland glycoprotein (Spt1)

Recombinant 16.5 kDa submandibular gland glycoprotein (Spt1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP355877MOYeast1mgQuote
EP355877MOE. coli1mgQuote
BP355877MOBaculovirus200ugQuote
MP355877MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP02815
Gene NameSpt1; aka: Spt-1
Protein Name16.5 kDa submandibular gland glycoprotein
Region Expressed20-138
Expression Tag6xHis
Purity>90%
AA SequenceQDPETNSTETSGTADSAGENTGSETQADSTDQNQEVDSSDSVEEENVNTDDTNTSYEATE EDNKEELNDNSTGDNTSDQNSGVDNTETEEESNAKTKLEDMKTVIKSGVEKLKNFLQRG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review