Request QuoteCatalog Number: xP326279RBSize: 0.2-1mg

Request Quote

Recombinant 15 kDa protein A

Recombinant 15 kDa protein A can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP326279RBYeast1mgQuote
EP326279RBE. coli1mgQuote
BP326279RBBaculovirus200ugQuote
MP326279RBMammalian Cell200ugQuote

Protein Information

SpeciesOryctolagus cuniculus (Rabbit)
UniProt IDP26202
Gene Name
Protein Name15 kDa protein A
Region Expressed21-137
Expression Tag6xHis
Purity>90%
AA SequenceIPRRRLRYEEVVAQALQFYNEGQQGQPLFRLLEATPPPSLNSKSRIPLNFRIKETVCIFT LDRQPGNCAFREGGEERICRGAFVRRRWVRALTLRCDRDQRRQPEFPRVTRPAGPTA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review