Request QuoteCatalog Number: xP603548OFGSize: 0.2-1mg

Request Quote

Recombinant 10 kDa prolamin (Os03g0766000, LOC_Os03g55730)

Recombinant 10 kDa prolamin (Os03g0766000, LOC_Os03g55730) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP603548OFGYeast1mgQuote
EP603548OFGE. coli1mgQuote
BP603548OFGBaculovirus200ugQuote
MP603548OFGMammalian Cell200ugQuote

Protein Information

SpeciesOryza sativa subsp. japonica (Rice)
UniProt IDQ0DN94
Gene NameLocus:Os03g0766000, LOC_Os03g55730
Protein Name10 kDa prolamin
Region Expressed25-134
Expression Tag6xHis
Purity>90%
AA SequenceITTMQYFPPTLAMGTMDPCRQYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCH CGTSCQMMQSMQQVICAGLGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review