Request QuoteCatalog Number: xP301254BVWSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin 1 (groS1)

Recombinant 10 kDa chaperonin 1 (groS1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP301254BVWYeast1mgQuote
EP301254BVWE. coli1mgQuote
BP301254BVWBaculovirus200ugQuote
MP301254BVWMammalian Cell200ugQuote

Protein Information

SpeciesBradyrhizobium japonicum (strain USDA 110)
UniProt IDP77828
Gene NamegroS1; aka: groES1; Locus:blr5226
Protein Name10 kDa chaperonin 1
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMHFRPLHDRVLVRRIDAEEKTAGGIIIPDTAKEKPQEGEIIAAGSGGRNEQGQLIPIDVK PGDRVLFGKWSGTEVKIDGQDYLIMKESDLLGVVDKTGSVKKAA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review