Request QuoteCatalog Number: xP633095Size: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP633095Yeast1mgQuote
EP633095E. coli1mgQuote
BP633095Baculovirus200ugQuote
MP633095Mammalian Cell200ugQuote

Protein Information

SpeciesBaumannia cicadellinicola subsp. Homalodisca coagulata
UniProt IDQ1LSP4
Gene NamegroS; aka: groES; Locus:BCI_0592
Protein Name10 kDa chaperonin
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMKIRPLHDRVIVKRKEVESKSAGGIMLTGSAAGKSTRGEVLAVGRGRSLDNGEIKALDVK VGDTIIFNDGYGVKVEKIDNEEVLIMSESDILAIVEK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review