Request QuoteCatalog Number: xP530809LNVSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP530809LNVYeast1mgQuote
EP530809LNVE. coli1mgQuote
BP530809LNVBaculovirus200ugQuote
MP530809LNVMammalian Cell200ugQuote

Protein Information

SpeciesLawsonia intracellularis
UniProt IDO87887
Gene NamegroS; aka: groES
Protein Name10 kDa chaperonin
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMNLKPLNDRVLVKRLESEEKTAGGLYIPDTAKEKPSRGEVVAVGPGKHTDDGKLIPMAVK AGDTVLFNKYAGTEVKLDGVEHLVMREDDILAVITGETGRK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review