10 kDa chaperonin (gr-->

Request QuoteCatalog Number: xP516404EJTSize: 0.2-1mg

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP516404EJT	Yeast	1mg	Quote
EP516404EJT	E. coli	1mg	Quote
BP516404EJT	Baculovirus	200ug	Quote
MP516404EJT	Mammalian Cell	200ug	Quote

Protein Information

Species	Ehrlichia sennetsu
UniProt ID	O32605
Gene Name	groS; aka: groES
Protein Name	10 kDa chaperonin
Region Expressed	1-98
Expression Tag	6xHis
Purity	>90%
AA Sequence	MKVGLKMLHDQVLIRPHEEKDGAGGIYIPDSAKKKPTMGLVVAVGAGAKNSNGTFQPVCV KEGDIVLYRKWAGSEVEHDGVEYVVMKETDIIAIKEGK
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products