Request QuoteCatalog Number: xP478004RKQSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP478004RKQYeast1mgQuote
EP478004RKQE. coli1mgQuote
BP478004RKQBaculovirus200ugQuote
MP478004RKQMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium leguminosarum bv. trifolii (strain WSM2304)
UniProt IDB5ZRD7
Gene NamegroS; aka: groES; Locus:Rleg2_0471
Protein Name
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMASTNFRPLHDRVVVRRVESEAKTKGGIIIPDTAKEKPQEGEIVAVGSGARDESGKVVAL DVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGIIG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review