Request QuoteCatalog Number: xP471968HUYSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP471968HUYYeast1mgQuote
EP471968HUYE. coli1mgQuote
BP471968HUYBaculovirus200ugQuote
MP471968HUYMammalian Cell200ugQuote

Protein Information

SpeciesHelicobacter pylori (strain P12)
UniProt IDB6JPA8
Gene NamegroS; aka: groES; Locus:HPP12_0009
Protein Name
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVI AFGKYKGTEIVLDGTEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review