Request QuoteCatalog Number: xP475604EOESize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP475604EOEYeast1mgQuote
EP475604EOEE. coli1mgQuote
BP475604EOEBaculovirus200ugQuote
MP475604EOEMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli O157:H7 (strain EC4115 / EHEC)
UniProt IDB5Z2F1
Gene NamegroS; aka: groES; Locus:ECH74115_5658
Protein Name
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMNIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEVLAVGNGRILENGEVKPLDVK VGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review