Request QuoteCatalog Number: xP457853LOTSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP457853LOTYeast1mgQuote
EP457853LOTE. coli1mgQuote
BP457853LOTBaculovirus200ugQuote
MP457853LOTMammalian Cell200ugQuote

Protein Information

SpeciesLeptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6) )
UniProt IDB1XXY8
Gene NamegroS; aka: groES; Locus:Lcho_0482
Protein Name
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMKLRPLHDRVIVKRLEQETKTASGIVIPDNAAEKPDQGEVLAVGPGKRNDKGDFVALNVA VGDRVLFGKYSGQTVKVDGDELLVMREEDLFAVVGK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review