Request QuoteCatalog Number: xP540118MTDSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP540118MTDYeast1mgQuote
EP540118MTDE. coli1mgQuote
BP540118MTDBaculovirus200ugQuote
MP540118MTDMammalian Cell200ugQuote

Protein Information

SpeciesMethylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)
UniProt IDB1LVA1
Gene NamegroS; aka: groES; Locus:Mrad2831_0535
Protein Name10 kDa chaperonin
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMKFRPLHDRVVVRRIESEEKTKGGIIIPDTAKEKPQEGEVVAVGPGARDEQGRVNALDVK AGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVVAL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review