Request QuoteCatalog Number: xP431230BPHSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP431230BPHYeast1mgQuote
EP431230BPHE. coli1mgQuote
BP431230BPHBaculovirus200ugQuote
MP431230BPHMammalian Cell200ugQuote

Protein Information

SpeciesBrucella canis (strain ATCC 23365 / NCTC 10854)
UniProt IDA9MDV2
Gene NamegroS; aka: groES; Locus:BCAN_B0196
Protein Name10 kDa chaperonin
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVVAAGAGARDEAGKLVPL DVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review