Request QuoteCatalog Number: xP392596PZJSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP392596PZJYeast1mgQuote
EP392596PZJE. coli1mgQuote
BP392596PZJBaculovirus200ugQuote
MP392596PZJMammalian Cell200ugQuote

Protein Information

SpeciesProsthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 265) ) (Chlorobium phaeovibrioides (strain DSM 265) )
UniProt IDA4SDP8
Gene NamegroS; aka: groES; Locus:Cvib_0585
Protein Name10 kDa chaperonin
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMNLKPLADRVIVKPAPAEEKTKGGLYIPDTGKEKPMYGEVVAVGAGKMSDSGQLLEMPVK AGDKVLYGKYSGTEVSVEGEDYLIMRESDIFAILG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review